Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MRH5

Protein Details
Accession R0MRH5    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-77KEIKNIKEEKKKEKIKIREYKERTGGBasic
NLS Segment(s)
PositionSequence
38-74IKLGAHVKKKQMDFKEIKNIKEEKKKEKIKIREYKER
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
Amino Acid Sequences MKRKKSNKINLFTKDLEKFIDEQKTQKERNSDLRSKIIKLGAHVKKKQMDFKEIKNIKEEKKKEKIKIREYKERTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.51
3 0.42
4 0.34
5 0.3
6 0.29
7 0.34
8 0.28
9 0.29
10 0.37
11 0.43
12 0.43
13 0.45
14 0.45
15 0.42
16 0.51
17 0.56
18 0.53
19 0.49
20 0.55
21 0.53
22 0.49
23 0.47
24 0.4
25 0.32
26 0.28
27 0.34
28 0.34
29 0.4
30 0.41
31 0.44
32 0.46
33 0.49
34 0.54
35 0.48
36 0.5
37 0.46
38 0.5
39 0.56
40 0.54
41 0.52
42 0.51
43 0.54
44 0.53
45 0.59
46 0.6
47 0.59
48 0.65
49 0.73
50 0.75
51 0.8
52 0.82
53 0.83
54 0.86
55 0.85
56 0.86
57 0.84