Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MIL9

Protein Details
Accession R0MIL9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
105-124TPSWRFYRKNPLKFVKVKNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 7, plas 6, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MQANKQKLYLNKQIKHEQTLSKYNPISCLTNKLYFSFSFFKPMNLLNKIDPPIDYHGQELAKKLFYLIIYLGYAISLGVGIIKSDLKYTLFAGILTVAICFVIITPSWRFYRKNPLKFVKVKNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.66
4 0.62
5 0.58
6 0.62
7 0.58
8 0.56
9 0.54
10 0.48
11 0.47
12 0.43
13 0.41
14 0.33
15 0.36
16 0.34
17 0.36
18 0.36
19 0.34
20 0.33
21 0.29
22 0.33
23 0.29
24 0.25
25 0.26
26 0.25
27 0.24
28 0.23
29 0.27
30 0.27
31 0.26
32 0.28
33 0.23
34 0.27
35 0.28
36 0.26
37 0.23
38 0.19
39 0.22
40 0.22
41 0.2
42 0.17
43 0.18
44 0.19
45 0.19
46 0.19
47 0.15
48 0.13
49 0.12
50 0.12
51 0.11
52 0.09
53 0.1
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.05
60 0.05
61 0.04
62 0.04
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03
68 0.04
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.09
75 0.1
76 0.11
77 0.11
78 0.11
79 0.11
80 0.1
81 0.09
82 0.08
83 0.07
84 0.05
85 0.04
86 0.04
87 0.04
88 0.03
89 0.04
90 0.05
91 0.08
92 0.11
93 0.15
94 0.19
95 0.23
96 0.26
97 0.3
98 0.41
99 0.49
100 0.56
101 0.61
102 0.67
103 0.73
104 0.8