Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KTU4

Protein Details
Accession R0KTU4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
255-281FDKLYGISKKYWRRKGKAKVFKNISLIHydrophilic
NLS Segment(s)
PositionSequence
266-272WRRKGKA
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR002554  PP2A_B56  
Gene Ontology GO:0000159  C:protein phosphatase type 2A complex  
GO:0019888  F:protein phosphatase regulator activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF01603  B56  
Amino Acid Sequences RNLNPTGPGFCQSDDTVFRNKVSTNINIFSKILEFLTLKCTSSRTIFVCFNDESLPNLFSLLKSEDEIERKNVCQTLKNIFDKKILCNEITRLLENEFQLFFVGSRTHIGMDLILNLFYYAFTVTKSISFCSYVENILFFIKKAQIEYFDDFKKIVLGFCTGNLKKSKFTLNFIYHHFEDVTYLRRVVLVEIIVDLFIFWKSHLKESVIRLTDLINSALSSGHHLLLEEVIGFFEHKEIYDLVKEQVDEFLPLIFDKLYGISKKYWRRKGKAKVFKNISLILNMSHCVFEKCLIDYNRRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.34
4 0.33
5 0.34
6 0.32
7 0.32
8 0.32
9 0.32
10 0.36
11 0.34
12 0.37
13 0.39
14 0.38
15 0.38
16 0.33
17 0.3
18 0.24
19 0.18
20 0.16
21 0.15
22 0.14
23 0.2
24 0.2
25 0.2
26 0.19
27 0.21
28 0.21
29 0.23
30 0.28
31 0.24
32 0.28
33 0.31
34 0.32
35 0.34
36 0.32
37 0.3
38 0.27
39 0.25
40 0.22
41 0.21
42 0.19
43 0.14
44 0.15
45 0.14
46 0.12
47 0.14
48 0.14
49 0.13
50 0.13
51 0.15
52 0.18
53 0.22
54 0.24
55 0.26
56 0.26
57 0.26
58 0.29
59 0.3
60 0.28
61 0.29
62 0.31
63 0.34
64 0.4
65 0.47
66 0.47
67 0.46
68 0.5
69 0.47
70 0.46
71 0.46
72 0.41
73 0.34
74 0.32
75 0.33
76 0.34
77 0.33
78 0.31
79 0.24
80 0.23
81 0.24
82 0.23
83 0.23
84 0.16
85 0.14
86 0.13
87 0.12
88 0.1
89 0.08
90 0.08
91 0.07
92 0.08
93 0.09
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.08
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.08
113 0.09
114 0.09
115 0.1
116 0.11
117 0.11
118 0.13
119 0.14
120 0.12
121 0.12
122 0.11
123 0.11
124 0.1
125 0.1
126 0.07
127 0.08
128 0.1
129 0.1
130 0.11
131 0.11
132 0.12
133 0.16
134 0.19
135 0.21
136 0.19
137 0.2
138 0.18
139 0.18
140 0.17
141 0.13
142 0.11
143 0.08
144 0.09
145 0.09
146 0.1
147 0.18
148 0.16
149 0.2
150 0.24
151 0.24
152 0.24
153 0.26
154 0.33
155 0.27
156 0.31
157 0.35
158 0.36
159 0.37
160 0.39
161 0.42
162 0.34
163 0.33
164 0.29
165 0.21
166 0.18
167 0.17
168 0.18
169 0.14
170 0.13
171 0.12
172 0.13
173 0.13
174 0.11
175 0.11
176 0.08
177 0.07
178 0.07
179 0.07
180 0.06
181 0.06
182 0.05
183 0.04
184 0.04
185 0.04
186 0.05
187 0.11
188 0.12
189 0.16
190 0.18
191 0.2
192 0.25
193 0.29
194 0.37
195 0.33
196 0.32
197 0.29
198 0.28
199 0.27
200 0.23
201 0.19
202 0.11
203 0.09
204 0.09
205 0.1
206 0.09
207 0.11
208 0.11
209 0.11
210 0.11
211 0.11
212 0.11
213 0.11
214 0.11
215 0.07
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.06
222 0.06
223 0.06
224 0.08
225 0.08
226 0.1
227 0.13
228 0.14
229 0.15
230 0.17
231 0.17
232 0.16
233 0.17
234 0.16
235 0.14
236 0.13
237 0.12
238 0.1
239 0.1
240 0.1
241 0.08
242 0.07
243 0.07
244 0.09
245 0.13
246 0.15
247 0.17
248 0.22
249 0.31
250 0.42
251 0.52
252 0.6
253 0.66
254 0.73
255 0.81
256 0.87
257 0.89
258 0.9
259 0.88
260 0.89
261 0.87
262 0.83
263 0.78
264 0.73
265 0.63
266 0.55
267 0.47
268 0.38
269 0.31
270 0.26
271 0.22
272 0.17
273 0.17
274 0.16
275 0.16
276 0.18
277 0.18
278 0.2
279 0.27
280 0.3
281 0.39