Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MLB4

Protein Details
Accession R0MLB4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
96-118YAFGKNSKNHLFRRSRKTKYRASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR010989  SNARE  
Gene Ontology GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
Amino Acid Sequences MLKQLSTSIKDKLKVHADDISNYQGDSLNYKLMKLHIKAHTRKLTELINRYRELQFIQKRNEEDRVQMLIKIANKENDSKQSLNSNPSVVNIAAQYAFGKNSKNHLFRRSRKTKYRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.47
4 0.43
5 0.4
6 0.42
7 0.37
8 0.29
9 0.26
10 0.24
11 0.19
12 0.17
13 0.17
14 0.15
15 0.17
16 0.16
17 0.17
18 0.17
19 0.19
20 0.25
21 0.24
22 0.31
23 0.33
24 0.42
25 0.47
26 0.55
27 0.59
28 0.54
29 0.53
30 0.48
31 0.47
32 0.44
33 0.47
34 0.44
35 0.42
36 0.41
37 0.43
38 0.4
39 0.35
40 0.3
41 0.32
42 0.32
43 0.33
44 0.37
45 0.37
46 0.39
47 0.41
48 0.44
49 0.36
50 0.31
51 0.28
52 0.27
53 0.23
54 0.22
55 0.2
56 0.17
57 0.19
58 0.2
59 0.19
60 0.19
61 0.2
62 0.23
63 0.25
64 0.29
65 0.31
66 0.29
67 0.29
68 0.33
69 0.34
70 0.35
71 0.33
72 0.28
73 0.24
74 0.24
75 0.25
76 0.17
77 0.16
78 0.12
79 0.11
80 0.1
81 0.1
82 0.1
83 0.09
84 0.11
85 0.11
86 0.15
87 0.16
88 0.24
89 0.33
90 0.4
91 0.45
92 0.54
93 0.63
94 0.69
95 0.78
96 0.8
97 0.81
98 0.84