Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MAA2

Protein Details
Accession R0MAA2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-75ACKYSPVKTKPKRRINILKEITERNKKKNSKKQLKEENRESEIHydrophilic
NLS Segment(s)
PositionSequence
40-66KTKPKRRINILKEITERNKKKNSKKQL
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MNVIPNFHKMRIERIDFNEEIESNDKENFDPSACKYSPVKTKPKRRINILKEITERNKKKNSKKQLKEENRESEIENLFQTFRSPLKKNKRTREM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.47
4 0.48
5 0.42
6 0.34
7 0.3
8 0.28
9 0.24
10 0.18
11 0.19
12 0.18
13 0.15
14 0.16
15 0.15
16 0.12
17 0.14
18 0.15
19 0.21
20 0.2
21 0.23
22 0.23
23 0.28
24 0.36
25 0.41
26 0.49
27 0.51
28 0.62
29 0.7
30 0.78
31 0.78
32 0.78
33 0.82
34 0.77
35 0.78
36 0.72
37 0.66
38 0.59
39 0.59
40 0.57
41 0.56
42 0.54
43 0.51
44 0.56
45 0.59
46 0.67
47 0.72
48 0.77
49 0.78
50 0.83
51 0.87
52 0.89
53 0.91
54 0.9
55 0.89
56 0.85
57 0.77
58 0.69
59 0.6
60 0.54
61 0.45
62 0.36
63 0.28
64 0.21
65 0.18
66 0.17
67 0.17
68 0.14
69 0.17
70 0.23
71 0.28
72 0.37
73 0.48
74 0.58
75 0.67