Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KX88

Protein Details
Accession R0KX88    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-100VQVWFQNERRNKRRKLRKEGKNISNDTHydrophilic
NLS Segment(s)
PositionSequence
82-94RRNKRRKLRKEGK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MDKDILKRESEIQAYLGLVKLKKRREETQKEISKYRKTPLQIKVLTEIFRMTEFPSTQTKMDLSLLIDLPIQTVQVWFQNERRNKRRKLRKEGKNISNDTESLFEISILTLVEIVKFCKKNLGYSQKDNTFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.19
4 0.17
5 0.17
6 0.22
7 0.28
8 0.34
9 0.42
10 0.47
11 0.55
12 0.62
13 0.71
14 0.72
15 0.76
16 0.78
17 0.74
18 0.75
19 0.73
20 0.7
21 0.64
22 0.61
23 0.56
24 0.52
25 0.56
26 0.56
27 0.58
28 0.52
29 0.5
30 0.5
31 0.47
32 0.43
33 0.35
34 0.28
35 0.19
36 0.16
37 0.15
38 0.11
39 0.12
40 0.11
41 0.13
42 0.17
43 0.18
44 0.18
45 0.18
46 0.17
47 0.15
48 0.15
49 0.13
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.07
56 0.07
57 0.06
58 0.06
59 0.04
60 0.04
61 0.05
62 0.08
63 0.1
64 0.11
65 0.15
66 0.23
67 0.3
68 0.4
69 0.49
70 0.55
71 0.63
72 0.72
73 0.79
74 0.82
75 0.86
76 0.88
77 0.88
78 0.9
79 0.91
80 0.9
81 0.87
82 0.8
83 0.72
84 0.64
85 0.54
86 0.44
87 0.35
88 0.27
89 0.19
90 0.16
91 0.12
92 0.09
93 0.09
94 0.08
95 0.06
96 0.06
97 0.05
98 0.05
99 0.07
100 0.07
101 0.1
102 0.18
103 0.19
104 0.19
105 0.27
106 0.29
107 0.35
108 0.45
109 0.53
110 0.53
111 0.61
112 0.7