Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MLJ8

Protein Details
Accession R0MLJ8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
137-157ELKIKFIRYCRSKKGNHYSSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 7, pero 5, cyto 3.5, E.R. 3, golg 3
Family & Domain DBs
Amino Acid Sequences MLNVFIFLNIIVCSTFFEDLTKQYKDFIIFHMEIEDVFYFVESNNLLMPNDKYRFITIKLHLSTLIKGLEITGVDAEEEHYIFERFEDVSNLLEMLKYFRNILNEIKNFRKYFASLITEEHLVIINKVDSFEKQFTELKIKFIRYCRSKKGNHYSSYRTNTASPSEFDRLSFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.12
5 0.13
6 0.18
7 0.24
8 0.24
9 0.22
10 0.23
11 0.26
12 0.27
13 0.27
14 0.24
15 0.26
16 0.24
17 0.24
18 0.23
19 0.21
20 0.17
21 0.19
22 0.16
23 0.09
24 0.08
25 0.08
26 0.07
27 0.07
28 0.08
29 0.06
30 0.06
31 0.07
32 0.08
33 0.08
34 0.1
35 0.12
36 0.18
37 0.19
38 0.2
39 0.2
40 0.22
41 0.25
42 0.26
43 0.31
44 0.27
45 0.33
46 0.33
47 0.32
48 0.31
49 0.29
50 0.27
51 0.22
52 0.19
53 0.11
54 0.1
55 0.1
56 0.09
57 0.08
58 0.07
59 0.05
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.09
86 0.1
87 0.13
88 0.15
89 0.19
90 0.24
91 0.27
92 0.31
93 0.35
94 0.4
95 0.38
96 0.38
97 0.36
98 0.29
99 0.28
100 0.29
101 0.27
102 0.22
103 0.23
104 0.23
105 0.22
106 0.21
107 0.18
108 0.15
109 0.11
110 0.1
111 0.1
112 0.09
113 0.08
114 0.1
115 0.1
116 0.1
117 0.15
118 0.17
119 0.16
120 0.19
121 0.21
122 0.23
123 0.32
124 0.31
125 0.33
126 0.36
127 0.39
128 0.41
129 0.45
130 0.53
131 0.53
132 0.6
133 0.63
134 0.68
135 0.71
136 0.77
137 0.81
138 0.8
139 0.78
140 0.77
141 0.75
142 0.76
143 0.75
144 0.68
145 0.59
146 0.53
147 0.48
148 0.47
149 0.42
150 0.34
151 0.34
152 0.36
153 0.33