Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M623

Protein Details
Accession R0M623    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-47YFVSTTKKKLNKQTLNNLNIHydrophilic
93-114NLLSYKRKKVNNKVGKDKKNLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039781  Rad21/Rec8-like  
IPR006910  Rad21_Rec8_N  
Gene Ontology GO:0008278  C:cohesin complex  
GO:0005634  C:nucleus  
GO:0007062  P:sister chromatid cohesion  
Pfam View protein in Pfam  
PF04825  Rad21_Rec8_N  
Amino Acid Sequences MYFPLNSVMFYAANLLSMKSNTELSIVYFVSTTKKKLNKQTLNNLNIQKILKSLLNPPQPFALRLYSYLVVGVVRIYLYKLKAYENEVQNLLNLLSYKRKKVNNKVGKDKKNLNKVNEDYEILLDDSSDHALDNITHQDYIHSGSILDPVHEDLIDIKPPKRFKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.14
6 0.13
7 0.14
8 0.12
9 0.13
10 0.13
11 0.12
12 0.15
13 0.14
14 0.12
15 0.11
16 0.11
17 0.17
18 0.19
19 0.2
20 0.25
21 0.33
22 0.4
23 0.5
24 0.61
25 0.64
26 0.71
27 0.78
28 0.8
29 0.77
30 0.77
31 0.69
32 0.59
33 0.53
34 0.45
35 0.34
36 0.25
37 0.23
38 0.17
39 0.16
40 0.21
41 0.25
42 0.33
43 0.33
44 0.33
45 0.36
46 0.35
47 0.34
48 0.31
49 0.26
50 0.18
51 0.19
52 0.21
53 0.17
54 0.16
55 0.15
56 0.13
57 0.09
58 0.08
59 0.07
60 0.04
61 0.03
62 0.03
63 0.04
64 0.06
65 0.07
66 0.08
67 0.09
68 0.1
69 0.12
70 0.16
71 0.22
72 0.22
73 0.23
74 0.23
75 0.22
76 0.21
77 0.2
78 0.15
79 0.09
80 0.08
81 0.07
82 0.15
83 0.17
84 0.21
85 0.27
86 0.34
87 0.42
88 0.53
89 0.63
90 0.64
91 0.71
92 0.78
93 0.82
94 0.83
95 0.81
96 0.8
97 0.77
98 0.77
99 0.76
100 0.69
101 0.68
102 0.62
103 0.61
104 0.54
105 0.47
106 0.37
107 0.3
108 0.27
109 0.18
110 0.15
111 0.1
112 0.08
113 0.08
114 0.08
115 0.07
116 0.06
117 0.06
118 0.06
119 0.07
120 0.09
121 0.12
122 0.12
123 0.12
124 0.12
125 0.13
126 0.14
127 0.17
128 0.16
129 0.12
130 0.11
131 0.12
132 0.16
133 0.15
134 0.15
135 0.12
136 0.12
137 0.13
138 0.13
139 0.13
140 0.11
141 0.14
142 0.2
143 0.22
144 0.23
145 0.3
146 0.39