Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MDQ1

Protein Details
Accession R0MDQ1    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MIPCVYSKQKKKKLKTWLDGFVVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018838  DUF2439  
Pfam View protein in Pfam  
PF10382  DUF2439  
Amino Acid Sequences MIPCVYSKQKKKKLKTWLDGFVVLKNNKMMLYDEDRKMIDSKTMSKLSNEMETMRHVIYVETECDFESEEVVKYENKMKFEPKVKPDEKIEGAINEIDGDDNNQQDEVQVCRSNEDILNLFIAPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.86
4 0.84
5 0.77
6 0.72
7 0.64
8 0.57
9 0.54
10 0.44
11 0.37
12 0.3
13 0.27
14 0.22
15 0.22
16 0.2
17 0.17
18 0.25
19 0.29
20 0.3
21 0.31
22 0.31
23 0.32
24 0.31
25 0.26
26 0.22
27 0.18
28 0.21
29 0.25
30 0.28
31 0.28
32 0.27
33 0.29
34 0.27
35 0.27
36 0.23
37 0.18
38 0.15
39 0.16
40 0.17
41 0.15
42 0.13
43 0.1
44 0.09
45 0.1
46 0.1
47 0.1
48 0.08
49 0.09
50 0.08
51 0.08
52 0.09
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.16
62 0.17
63 0.19
64 0.21
65 0.24
66 0.3
67 0.37
68 0.43
69 0.42
70 0.5
71 0.49
72 0.51
73 0.52
74 0.52
75 0.47
76 0.42
77 0.38
78 0.28
79 0.28
80 0.23
81 0.2
82 0.13
83 0.11
84 0.08
85 0.07
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.1
92 0.11
93 0.12
94 0.12
95 0.16
96 0.2
97 0.2
98 0.22
99 0.23
100 0.25
101 0.24
102 0.25
103 0.22
104 0.19
105 0.2