Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MPY2

Protein Details
Accession R0MPY2   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
70-90KWESFANKKGIKKRKGRLVYDHydrophilic
NLS Segment(s)
PositionSequence
77-86KKGIKKRKGR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences METYLDYLTVIQNSNNDTDLNKEASEMIKNIRSLVKQQKSVQKDVDLIYIVDRTDLKIPKQHSELKSQTKWESFANKKGIKKRKGRLVYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.13
5 0.17
6 0.19
7 0.18
8 0.16
9 0.15
10 0.15
11 0.17
12 0.18
13 0.15
14 0.15
15 0.17
16 0.17
17 0.18
18 0.2
19 0.2
20 0.25
21 0.34
22 0.37
23 0.39
24 0.44
25 0.51
26 0.52
27 0.55
28 0.5
29 0.41
30 0.37
31 0.32
32 0.28
33 0.2
34 0.16
35 0.13
36 0.12
37 0.1
38 0.08
39 0.08
40 0.08
41 0.13
42 0.15
43 0.16
44 0.2
45 0.23
46 0.27
47 0.32
48 0.39
49 0.36
50 0.43
51 0.49
52 0.53
53 0.55
54 0.55
55 0.55
56 0.49
57 0.49
58 0.45
59 0.47
60 0.43
61 0.48
62 0.52
63 0.54
64 0.59
65 0.67
66 0.73
67 0.72
68 0.77
69 0.79
70 0.8