Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MK64

Protein Details
Accession R0MK64    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MIPCVYSKQKKKKLKTWFDGFVVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018838  DUF2439  
Pfam View protein in Pfam  
PF10382  DUF2439  
Amino Acid Sequences MIPCVYSKQKKKKLKTWFDGFVVLKNNKMMLYDEDKKMIDSKTMPKLSNEMETMRHVIYVETECDFESEEVVKYENKVKFEPKVKPDEKIEDVINEINDDNNQQDEVQVCRSNEDILNLFMAPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.86
4 0.82
5 0.75
6 0.72
7 0.63
8 0.56
9 0.53
10 0.44
11 0.37
12 0.31
13 0.29
14 0.22
15 0.22
16 0.2
17 0.17
18 0.24
19 0.28
20 0.28
21 0.3
22 0.3
23 0.3
24 0.3
25 0.26
26 0.21
27 0.19
28 0.24
29 0.31
30 0.35
31 0.35
32 0.33
33 0.35
34 0.34
35 0.34
36 0.29
37 0.21
38 0.19
39 0.19
40 0.21
41 0.17
42 0.16
43 0.12
44 0.11
45 0.11
46 0.1
47 0.1
48 0.08
49 0.09
50 0.08
51 0.08
52 0.09
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.09
61 0.16
62 0.17
63 0.19
64 0.21
65 0.24
66 0.3
67 0.37
68 0.43
69 0.42
70 0.5
71 0.49
72 0.52
73 0.53
74 0.53
75 0.49
76 0.44
77 0.39
78 0.3
79 0.3
80 0.27
81 0.23
82 0.17
83 0.14
84 0.12
85 0.11
86 0.12
87 0.1
88 0.1
89 0.1
90 0.09
91 0.1
92 0.11
93 0.14
94 0.18
95 0.21
96 0.21
97 0.22
98 0.23
99 0.25
100 0.24
101 0.25
102 0.22
103 0.19
104 0.2