Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CWV5

Protein Details
Accession B0CWV5    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-34LEKLDKCSQCSKRKSRLLLCSGCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.5, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
KEGG lbc:LACBIDRAFT_308645  -  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MPPHKETVYLPLEKLDKCSQCSKRKSRLLLCSGCGERIYCSKECQQTDWKAHKVSCGGYIVYIQCPTSHSRSCTLGKTHRIDLNAFYPFLACLSELNHLHAQKPTHNALRHKIINSPNPDSDEIIDCPDGTTALLIHLGEEIPLSEGLNGTEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.36
4 0.38
5 0.48
6 0.52
7 0.58
8 0.68
9 0.71
10 0.74
11 0.78
12 0.83
13 0.82
14 0.82
15 0.82
16 0.76
17 0.68
18 0.65
19 0.58
20 0.49
21 0.41
22 0.32
23 0.25
24 0.25
25 0.28
26 0.22
27 0.25
28 0.3
29 0.37
30 0.38
31 0.4
32 0.43
33 0.45
34 0.53
35 0.57
36 0.54
37 0.51
38 0.49
39 0.48
40 0.42
41 0.35
42 0.29
43 0.24
44 0.19
45 0.16
46 0.17
47 0.15
48 0.14
49 0.13
50 0.1
51 0.09
52 0.11
53 0.13
54 0.16
55 0.18
56 0.19
57 0.21
58 0.25
59 0.27
60 0.29
61 0.31
62 0.32
63 0.36
64 0.37
65 0.39
66 0.37
67 0.36
68 0.33
69 0.3
70 0.28
71 0.22
72 0.19
73 0.15
74 0.13
75 0.12
76 0.11
77 0.09
78 0.05
79 0.05
80 0.06
81 0.11
82 0.11
83 0.15
84 0.18
85 0.18
86 0.2
87 0.22
88 0.23
89 0.22
90 0.27
91 0.28
92 0.32
93 0.37
94 0.4
95 0.42
96 0.49
97 0.5
98 0.46
99 0.48
100 0.47
101 0.49
102 0.51
103 0.51
104 0.45
105 0.44
106 0.45
107 0.39
108 0.34
109 0.3
110 0.25
111 0.22
112 0.2
113 0.16
114 0.15
115 0.14
116 0.12
117 0.09
118 0.08
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.07
130 0.07
131 0.08
132 0.07
133 0.08