Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MKG9

Protein Details
Accession R0MKG9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKIISWSDSKRNKNRFRKPSKVGKMFAHydrophilic
NLS Segment(s)
PositionSequence
11-20RNKNRFRKPS
Subcellular Location(s) nucl 14, mito_nucl 13.5, mito 11
Family & Domain DBs
Amino Acid Sequences MKIISWSDSKRNKNRFRKPSKVGKMFAYRYDGKEVILENDVDYFMGNSGDIFFLSDKIRAKNLYEIVVMSLDGKCRKRFEVDDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.9
4 0.9
5 0.89
6 0.9
7 0.89
8 0.86
9 0.78
10 0.75
11 0.73
12 0.65
13 0.6
14 0.55
15 0.46
16 0.4
17 0.42
18 0.35
19 0.27
20 0.25
21 0.23
22 0.18
23 0.17
24 0.14
25 0.09
26 0.09
27 0.09
28 0.07
29 0.07
30 0.05
31 0.04
32 0.04
33 0.04
34 0.03
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.08
42 0.11
43 0.13
44 0.15
45 0.18
46 0.18
47 0.2
48 0.25
49 0.27
50 0.26
51 0.24
52 0.22
53 0.21
54 0.2
55 0.17
56 0.12
57 0.11
58 0.14
59 0.2
60 0.24
61 0.28
62 0.32
63 0.35
64 0.41