Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MGH8

Protein Details
Accession R0MGH8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-114DREIAEKRNKKKICRRCNKKQALKATNCRGKTHydrophilic
NLS Segment(s)
PositionSequence
123-131KKALKVVKK
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MFLNVKLFDKTSFYEVTPEQSLVSLKEEISRRNGVEYNSLRLVYNTRSLNDNDLIGMHNLQNLSMVQAFVTCLGGGNQLAENDREIAEKRNKKKICRRCNKKQALKATNCRGKTCGSKDLRLKKALKVVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.27
4 0.26
5 0.24
6 0.2
7 0.19
8 0.19
9 0.16
10 0.19
11 0.15
12 0.13
13 0.18
14 0.21
15 0.22
16 0.26
17 0.29
18 0.26
19 0.29
20 0.31
21 0.27
22 0.33
23 0.33
24 0.32
25 0.31
26 0.31
27 0.27
28 0.25
29 0.26
30 0.19
31 0.23
32 0.2
33 0.19
34 0.21
35 0.22
36 0.24
37 0.22
38 0.2
39 0.14
40 0.13
41 0.13
42 0.1
43 0.11
44 0.07
45 0.08
46 0.07
47 0.07
48 0.07
49 0.06
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.16
74 0.25
75 0.33
76 0.39
77 0.48
78 0.53
79 0.62
80 0.71
81 0.76
82 0.77
83 0.81
84 0.84
85 0.86
86 0.92
87 0.93
88 0.93
89 0.9
90 0.9
91 0.89
92 0.89
93 0.87
94 0.87
95 0.84
96 0.76
97 0.7
98 0.61
99 0.56
100 0.56
101 0.52
102 0.51
103 0.48
104 0.54
105 0.61
106 0.7
107 0.72
108 0.71
109 0.68
110 0.64
111 0.69