Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MFQ0

Protein Details
Accession R0MFQ0   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSADIAKKLRQRQQQRIKSQKAPEGHydrophilic
27-46PFAPRKRPPVRAKQGRIKREBasic
NLS Segment(s)
PositionSequence
9-47LRQRQQQRIKSQKAPEGSPFAPRKRPPVRAKQGRIKREM
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006522  Phage_virion_morphogenesis  
Pfam View protein in Pfam  
PF05069  Phage_tail_S  
Amino Acid Sequences MSADIAKKLRQRQQQRIKSQKAPEGSPFAPRKRPPVRAKQGRIKREMFAKLRTNRYMKASGGDSALVVEFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.88
4 0.88
5 0.86
6 0.82
7 0.77
8 0.69
9 0.62
10 0.55
11 0.51
12 0.44
13 0.44
14 0.44
15 0.41
16 0.45
17 0.44
18 0.49
19 0.5
20 0.59
21 0.57
22 0.62
23 0.7
24 0.72
25 0.78
26 0.78
27 0.8
28 0.77
29 0.76
30 0.68
31 0.6
32 0.56
33 0.57
34 0.51
35 0.49
36 0.52
37 0.53
38 0.58
39 0.62
40 0.59
41 0.54
42 0.56
43 0.53
44 0.45
45 0.42
46 0.37
47 0.31
48 0.29
49 0.26
50 0.2
51 0.16