Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KWJ7

Protein Details
Accession R0KWJ7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRREIQKKTKEDKQNSLLKFHydrophilic
153-176KQCEILKNLKKKFKKVPVNIIQIWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR043164  RL10_insert_sf  
Amino Acid Sequences MKRREIQKKTKEDKQNSLLKFESNLKTYPLVAAIENTDLSNNFLKSIRNEIENTQTCMVKKKMFLSKFKIENLNDKNFVFVFTDKNGIEKLKEYKYKTFLEEGDESVEEVVIDKGIIKDKELAELLPTLTKDNLEYLEEDYKVCSVGEILNEKQCEILKNLKKKFKKVPVNIIQIWDSENFENNKNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.72
4 0.69
5 0.6
6 0.51
7 0.46
8 0.45
9 0.41
10 0.35
11 0.34
12 0.31
13 0.31
14 0.3
15 0.27
16 0.21
17 0.17
18 0.14
19 0.14
20 0.13
21 0.13
22 0.13
23 0.12
24 0.11
25 0.1
26 0.12
27 0.14
28 0.13
29 0.13
30 0.14
31 0.17
32 0.18
33 0.25
34 0.24
35 0.24
36 0.26
37 0.26
38 0.35
39 0.35
40 0.37
41 0.31
42 0.31
43 0.29
44 0.33
45 0.34
46 0.27
47 0.27
48 0.3
49 0.37
50 0.41
51 0.47
52 0.49
53 0.54
54 0.55
55 0.56
56 0.56
57 0.49
58 0.52
59 0.52
60 0.49
61 0.43
62 0.39
63 0.36
64 0.29
65 0.29
66 0.21
67 0.16
68 0.13
69 0.12
70 0.15
71 0.14
72 0.15
73 0.15
74 0.13
75 0.13
76 0.14
77 0.18
78 0.2
79 0.26
80 0.29
81 0.32
82 0.37
83 0.38
84 0.37
85 0.35
86 0.29
87 0.28
88 0.26
89 0.22
90 0.19
91 0.17
92 0.15
93 0.12
94 0.11
95 0.06
96 0.06
97 0.05
98 0.03
99 0.03
100 0.04
101 0.05
102 0.1
103 0.1
104 0.1
105 0.15
106 0.15
107 0.18
108 0.18
109 0.17
110 0.13
111 0.14
112 0.14
113 0.11
114 0.11
115 0.1
116 0.1
117 0.1
118 0.1
119 0.1
120 0.11
121 0.1
122 0.11
123 0.13
124 0.16
125 0.16
126 0.16
127 0.15
128 0.14
129 0.13
130 0.12
131 0.09
132 0.06
133 0.08
134 0.11
135 0.15
136 0.17
137 0.21
138 0.22
139 0.22
140 0.23
141 0.23
142 0.22
143 0.22
144 0.3
145 0.34
146 0.44
147 0.52
148 0.6
149 0.66
150 0.72
151 0.79
152 0.79
153 0.82
154 0.81
155 0.83
156 0.83
157 0.85
158 0.79
159 0.72
160 0.62
161 0.52
162 0.44
163 0.35
164 0.28
165 0.21
166 0.24
167 0.23