Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KP13

Protein Details
Accession R0KP13    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-127IIEGARVKKRQPRKKDFHIPCVHydrophilic
NLS Segment(s)
PositionSequence
113-119KKRQPRK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MEDSKIWVIDQKAYTTIRQSDRTKFKNIVLKGLKKCKFFKDFQYEELKAISKVLDFRYCIVGTVHPVQEDEIFIFTRNGKIKFEDGNIKEIKKSEYVTATFECLSIIEGARVKKRQPRKKDFHIPCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.36
4 0.35
5 0.41
6 0.44
7 0.49
8 0.57
9 0.6
10 0.61
11 0.57
12 0.57
13 0.58
14 0.54
15 0.55
16 0.53
17 0.58
18 0.6
19 0.67
20 0.66
21 0.63
22 0.67
23 0.65
24 0.63
25 0.57
26 0.59
27 0.59
28 0.56
29 0.55
30 0.59
31 0.51
32 0.46
33 0.43
34 0.34
35 0.24
36 0.22
37 0.17
38 0.1
39 0.11
40 0.13
41 0.14
42 0.14
43 0.15
44 0.18
45 0.18
46 0.17
47 0.16
48 0.14
49 0.14
50 0.16
51 0.15
52 0.12
53 0.12
54 0.12
55 0.11
56 0.11
57 0.09
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.13
64 0.17
65 0.18
66 0.18
67 0.2
68 0.22
69 0.23
70 0.26
71 0.31
72 0.28
73 0.33
74 0.34
75 0.33
76 0.32
77 0.31
78 0.3
79 0.24
80 0.24
81 0.21
82 0.24
83 0.24
84 0.26
85 0.26
86 0.26
87 0.23
88 0.21
89 0.18
90 0.13
91 0.13
92 0.1
93 0.09
94 0.1
95 0.13
96 0.17
97 0.24
98 0.28
99 0.32
100 0.4
101 0.51
102 0.58
103 0.66
104 0.74
105 0.77
106 0.84
107 0.9