Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0E566

Protein Details
Accession B0E566    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-81KLPHQCRKPCNSRPLRRWYHKWKYRPNHTKHTQLFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_316678  -  
Amino Acid Sequences HVTGHQTHHTYRGLCTTTRNGKTSHDLGKHDATRNKQMIFLPPALKLPHQCRKPCNSRPLRRWYHKWKYRPNHTKHTQLFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.36
4 0.42
5 0.45
6 0.46
7 0.4
8 0.41
9 0.46
10 0.47
11 0.45
12 0.4
13 0.38
14 0.4
15 0.45
16 0.46
17 0.45
18 0.45
19 0.41
20 0.45
21 0.45
22 0.42
23 0.38
24 0.35
25 0.34
26 0.32
27 0.31
28 0.24
29 0.21
30 0.23
31 0.21
32 0.22
33 0.21
34 0.26
35 0.32
36 0.38
37 0.41
38 0.45
39 0.54
40 0.63
41 0.66
42 0.69
43 0.72
44 0.75
45 0.79
46 0.84
47 0.85
48 0.84
49 0.86
50 0.86
51 0.86
52 0.85
53 0.87
54 0.87
55 0.88
56 0.9
57 0.91
58 0.88
59 0.88
60 0.86
61 0.86