Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MIC9

Protein Details
Accession R0MIC9    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21QDKMIKERKNIFKINKHFILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, mito_nucl 10.166, cyto_nucl 9.333, nucl 8.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
Amino Acid Sequences MQDKMIKERKNIFKINKHFILSKGYNKVYQLKNFLRAGKIPYQLKPDDKVEEVYKNATYMYKLRVKDMSVTSFPIGHTKMENDALYDNLKHVFGVIVGALKKGEDNIKNVFLKGAQKTPKKIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.76
4 0.69
5 0.62
6 0.55
7 0.55
8 0.5
9 0.49
10 0.48
11 0.44
12 0.43
13 0.44
14 0.5
15 0.47
16 0.47
17 0.48
18 0.44
19 0.48
20 0.49
21 0.49
22 0.43
23 0.39
24 0.39
25 0.37
26 0.4
27 0.36
28 0.36
29 0.39
30 0.4
31 0.4
32 0.39
33 0.36
34 0.32
35 0.3
36 0.29
37 0.26
38 0.25
39 0.23
40 0.22
41 0.19
42 0.16
43 0.15
44 0.13
45 0.12
46 0.11
47 0.15
48 0.19
49 0.19
50 0.21
51 0.22
52 0.23
53 0.26
54 0.27
55 0.26
56 0.21
57 0.22
58 0.21
59 0.2
60 0.19
61 0.18
62 0.16
63 0.13
64 0.13
65 0.12
66 0.14
67 0.16
68 0.16
69 0.14
70 0.14
71 0.14
72 0.15
73 0.14
74 0.13
75 0.11
76 0.11
77 0.09
78 0.09
79 0.08
80 0.06
81 0.07
82 0.06
83 0.08
84 0.08
85 0.09
86 0.09
87 0.09
88 0.09
89 0.11
90 0.18
91 0.17
92 0.21
93 0.25
94 0.33
95 0.34
96 0.34
97 0.33
98 0.29
99 0.33
100 0.34
101 0.38
102 0.4
103 0.47