Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MBE7

Protein Details
Accession R0MBE7    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-42LTKTGKVRNQTPKVPKQEKRRSRTGRARQRRVYEHRBasic
NLS Segment(s)
PositionSequence
18-37PKVPKQEKRRSRTGRARQRR
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MAKQISLTKTGKVRNQTPKVPKQEKRRSRTGRARQRRVYEHRVEIGYFECNGKMKLNIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.67
4 0.7
5 0.73
6 0.78
7 0.8
8 0.79
9 0.79
10 0.83
11 0.84
12 0.8
13 0.82
14 0.79
15 0.8
16 0.83
17 0.82
18 0.83
19 0.84
20 0.87
21 0.83
22 0.83
23 0.82
24 0.79
25 0.77
26 0.72
27 0.66
28 0.61
29 0.55
30 0.48
31 0.4
32 0.33
33 0.26
34 0.21
35 0.17
36 0.14
37 0.15
38 0.16
39 0.17
40 0.22