Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MKQ6

Protein Details
Accession R0MKQ6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-88VCKLECTKCKRVHQTAHKRAKHVHydrophilic
NLS Segment(s)
PositionSequence
28-63KGKDNPDAKGNRRYRLKQKTLGQTRPILKRKAKVTK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
Amino Acid Sequences MVNIPKTKNTFCSKCNKHSLHKVSLYKKGKDNPDAKGNRRYRLKQKTLGQTRPILKRKAKVTKKIVCKLECTKCKRVHQTAHKRAKHVVIGGEKKTKGEALAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.71
3 0.7
4 0.69
5 0.74
6 0.76
7 0.74
8 0.75
9 0.74
10 0.7
11 0.74
12 0.72
13 0.66
14 0.65
15 0.64
16 0.62
17 0.63
18 0.61
19 0.56
20 0.59
21 0.62
22 0.6
23 0.63
24 0.6
25 0.59
26 0.62
27 0.64
28 0.64
29 0.68
30 0.7
31 0.68
32 0.71
33 0.74
34 0.75
35 0.74
36 0.66
37 0.62
38 0.61
39 0.62
40 0.59
41 0.56
42 0.5
43 0.51
44 0.56
45 0.61
46 0.63
47 0.64
48 0.68
49 0.7
50 0.75
51 0.78
52 0.76
53 0.67
54 0.66
55 0.65
56 0.65
57 0.66
58 0.64
59 0.65
60 0.66
61 0.73
62 0.76
63 0.76
64 0.76
65 0.78
66 0.82
67 0.84
68 0.87
69 0.82
70 0.76
71 0.72
72 0.67
73 0.61
74 0.52
75 0.49
76 0.48
77 0.5
78 0.53
79 0.56
80 0.5
81 0.46
82 0.45
83 0.39