Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MC46

Protein Details
Accession R0MC46    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-65VFRFCRSKCTKAFKKHRNPRKTKWTKISRKVRGKDLMDHydrophilic
NLS Segment(s)
PositionSequence
39-61AFKKHRNPRKTKWTKISRKVRGK
Subcellular Location(s) nucl 13, mito_nucl 12.166, mito 10, cyto_nucl 8.666, cyto_mito 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEKCYFCSSNIYPGHGSIFVRNDSTVFRFCRSKCTKAFKKHRNPRKTKWTKISRKVRGKDLMDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.32
4 0.26
5 0.25
6 0.19
7 0.2
8 0.17
9 0.18
10 0.17
11 0.15
12 0.15
13 0.17
14 0.18
15 0.17
16 0.19
17 0.23
18 0.23
19 0.33
20 0.37
21 0.4
22 0.43
23 0.52
24 0.59
25 0.65
26 0.76
27 0.76
28 0.82
29 0.86
30 0.9
31 0.9
32 0.9
33 0.9
34 0.9
35 0.9
36 0.89
37 0.89
38 0.9
39 0.89
40 0.91
41 0.92
42 0.91
43 0.91
44 0.88
45 0.86
46 0.84