Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KUA3

Protein Details
Accession R0KUA3    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MESPLKQRRNKILKRLNITLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MESPLKQRRNKILKRLNITLNTTFNTIIDINKSLESIIKMNKSLEETSEIFKIWREKMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.75
4 0.69
5 0.65
6 0.58
7 0.51
8 0.43
9 0.37
10 0.3
11 0.23
12 0.2
13 0.15
14 0.12
15 0.11
16 0.11
17 0.11
18 0.11
19 0.11
20 0.09
21 0.1
22 0.11
23 0.12
24 0.14
25 0.16
26 0.17
27 0.17
28 0.19
29 0.21
30 0.21
31 0.2
32 0.21
33 0.2
34 0.22
35 0.23
36 0.21
37 0.18
38 0.22
39 0.26