Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MRM0

Protein Details
Accession R0MRM0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-68PEIVKECKKKSRKIKEKCKEVKDEEDEBasic
NLS Segment(s)
PositionSequence
49-58KKKSRKIKEK
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MINEILTKFLQTTKFTTSKTERNFVPRRVGLGYDLVTEFNDPEIVKECKKKSRKIKEKCKEVKDEEDEPSKLSLMKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.4
4 0.42
5 0.46
6 0.49
7 0.5
8 0.45
9 0.51
10 0.57
11 0.53
12 0.56
13 0.48
14 0.45
15 0.42
16 0.4
17 0.31
18 0.26
19 0.23
20 0.15
21 0.14
22 0.12
23 0.1
24 0.1
25 0.08
26 0.06
27 0.07
28 0.05
29 0.06
30 0.1
31 0.12
32 0.15
33 0.22
34 0.26
35 0.34
36 0.41
37 0.5
38 0.57
39 0.66
40 0.74
41 0.79
42 0.86
43 0.87
44 0.91
45 0.92
46 0.89
47 0.87
48 0.82
49 0.81
50 0.76
51 0.7
52 0.64
53 0.61
54 0.53
55 0.46
56 0.41
57 0.32
58 0.28
59 0.28