Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MJ46

Protein Details
Accession R0MJ46    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-33NTSSDEQKRNFKREKLKLKKIYYNFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MFTSLNENTSSDEQKRNFKREKLKLKKIYYNFLLNNKLDDIWNYKLQFEENRGYYERIRENALYNFVQKSKRLNIEKYQLTKYSKPLLEYISLIIDDNQLLKARKLLNIAKGNGFTCNKYYELDLKIREKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.54
3 0.59
4 0.62
5 0.65
6 0.72
7 0.75
8 0.82
9 0.83
10 0.86
11 0.87
12 0.87
13 0.88
14 0.81
15 0.79
16 0.72
17 0.69
18 0.63
19 0.59
20 0.57
21 0.48
22 0.44
23 0.37
24 0.33
25 0.25
26 0.22
27 0.21
28 0.19
29 0.24
30 0.23
31 0.22
32 0.22
33 0.23
34 0.24
35 0.23
36 0.24
37 0.2
38 0.23
39 0.24
40 0.26
41 0.25
42 0.28
43 0.26
44 0.23
45 0.24
46 0.22
47 0.23
48 0.22
49 0.24
50 0.2
51 0.19
52 0.18
53 0.19
54 0.2
55 0.18
56 0.21
57 0.22
58 0.3
59 0.33
60 0.36
61 0.4
62 0.46
63 0.5
64 0.5
65 0.48
66 0.45
67 0.46
68 0.44
69 0.42
70 0.42
71 0.38
72 0.36
73 0.34
74 0.31
75 0.28
76 0.26
77 0.23
78 0.16
79 0.14
80 0.13
81 0.11
82 0.1
83 0.08
84 0.08
85 0.08
86 0.11
87 0.12
88 0.13
89 0.17
90 0.19
91 0.21
92 0.27
93 0.3
94 0.36
95 0.42
96 0.44
97 0.43
98 0.44
99 0.42
100 0.42
101 0.4
102 0.33
103 0.28
104 0.28
105 0.26
106 0.24
107 0.28
108 0.27
109 0.3
110 0.34
111 0.38