Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DNE1

Protein Details
Accession B0DNE1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-112IPSAEEKKGKPRDRHKPYAPRRGNGABasic
NLS Segment(s)
PositionSequence
93-109KKGKPRDRHKPYAPRRG
Subcellular Location(s) cyto_nucl 10.833, cyto 9.5, cyto_mito 8.832, nucl 8, mito 6.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_331078  -  
Amino Acid Sequences MNFVTLEHIGSLYPVEMLKNRLSYAFRTPLSPSQQSVLLRHRFVLVTESNGHPTGRQGTNLIYRFTGYLPVHLIVPEFFRTKVYPDIPSAEEKKGKPRDRHKPYAPRRGNGAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.14
5 0.17
6 0.18
7 0.18
8 0.21
9 0.23
10 0.24
11 0.29
12 0.33
13 0.3
14 0.3
15 0.33
16 0.37
17 0.41
18 0.4
19 0.34
20 0.29
21 0.33
22 0.32
23 0.33
24 0.34
25 0.32
26 0.31
27 0.3
28 0.3
29 0.25
30 0.24
31 0.24
32 0.16
33 0.14
34 0.16
35 0.17
36 0.17
37 0.18
38 0.17
39 0.13
40 0.14
41 0.16
42 0.15
43 0.14
44 0.13
45 0.15
46 0.22
47 0.23
48 0.23
49 0.18
50 0.17
51 0.17
52 0.17
53 0.21
54 0.14
55 0.14
56 0.15
57 0.15
58 0.15
59 0.14
60 0.14
61 0.08
62 0.1
63 0.12
64 0.11
65 0.11
66 0.13
67 0.14
68 0.16
69 0.22
70 0.23
71 0.23
72 0.24
73 0.27
74 0.27
75 0.33
76 0.33
77 0.33
78 0.36
79 0.35
80 0.43
81 0.5
82 0.57
83 0.61
84 0.68
85 0.74
86 0.78
87 0.86
88 0.87
89 0.88
90 0.89
91 0.91
92 0.88
93 0.81
94 0.78