Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MB44

Protein Details
Accession R0MB44   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-53KDNLITCKIWKKTKKCRTDCPLRHSEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041686  Znf-CCCH_3  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF15663  zf-CCCH_3  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MEDCYFFLYSDCKLKDRCMYRHNPISKDNLITCKIWKKTKKCRTDCPLRHSEYHELKQRKETMCYWEDKGGCTKYRCEYKHKDPVKDEWKEVKVKSLTEIKNLKNTIEIENEKKTEIDISNSEVIEDVKSVIREETNEQNINEIVEPVLSKRGFTIEPIEIKRPKIETPKEFDDLDKELQELDDLLNEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.48
4 0.53
5 0.55
6 0.61
7 0.66
8 0.74
9 0.76
10 0.72
11 0.67
12 0.66
13 0.6
14 0.57
15 0.51
16 0.47
17 0.43
18 0.39
19 0.41
20 0.42
21 0.45
22 0.49
23 0.55
24 0.59
25 0.68
26 0.76
27 0.82
28 0.81
29 0.85
30 0.85
31 0.88
32 0.86
33 0.83
34 0.82
35 0.76
36 0.71
37 0.66
38 0.65
39 0.62
40 0.6
41 0.61
42 0.56
43 0.54
44 0.58
45 0.6
46 0.53
47 0.49
48 0.45
49 0.42
50 0.42
51 0.43
52 0.39
53 0.36
54 0.34
55 0.31
56 0.34
57 0.3
58 0.31
59 0.29
60 0.3
61 0.31
62 0.39
63 0.41
64 0.44
65 0.49
66 0.53
67 0.62
68 0.65
69 0.65
70 0.59
71 0.66
72 0.66
73 0.6
74 0.55
75 0.51
76 0.49
77 0.47
78 0.44
79 0.41
80 0.34
81 0.31
82 0.31
83 0.33
84 0.29
85 0.33
86 0.38
87 0.33
88 0.38
89 0.38
90 0.35
91 0.29
92 0.3
93 0.25
94 0.25
95 0.27
96 0.24
97 0.27
98 0.27
99 0.24
100 0.23
101 0.2
102 0.18
103 0.16
104 0.16
105 0.13
106 0.16
107 0.18
108 0.18
109 0.18
110 0.15
111 0.14
112 0.11
113 0.1
114 0.08
115 0.07
116 0.08
117 0.09
118 0.09
119 0.09
120 0.11
121 0.14
122 0.21
123 0.25
124 0.28
125 0.27
126 0.28
127 0.28
128 0.27
129 0.23
130 0.16
131 0.1
132 0.08
133 0.08
134 0.08
135 0.14
136 0.13
137 0.13
138 0.13
139 0.16
140 0.16
141 0.17
142 0.22
143 0.2
144 0.27
145 0.31
146 0.38
147 0.38
148 0.39
149 0.42
150 0.4
151 0.41
152 0.45
153 0.51
154 0.51
155 0.56
156 0.6
157 0.59
158 0.57
159 0.52
160 0.47
161 0.41
162 0.38
163 0.3
164 0.24
165 0.21
166 0.2
167 0.19
168 0.15
169 0.11
170 0.11