Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KV92

Protein Details
Accession R0KV92    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-101QVWFQNERRSRRRKLRKEGKSIPQEDEHydrophilic
NLS Segment(s)
PositionSequence
82-94RRSRRRKLRKEGK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MDREFVKRESEIQAYLGLIKLKKRRGDNTNDGCKYRKSPLQVKILSEVFRLTGYPSTQTKLDLSLLIDLPIQTVQVWFQNERRSRRRKLRKEGKSIPQEDEELFEISILTLVDIIKDCRKSLGLYRSNNMFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.18
5 0.17
6 0.22
7 0.28
8 0.34
9 0.4
10 0.47
11 0.53
12 0.58
13 0.66
14 0.7
15 0.73
16 0.77
17 0.74
18 0.69
19 0.63
20 0.58
21 0.52
22 0.47
23 0.42
24 0.38
25 0.43
26 0.49
27 0.56
28 0.56
29 0.53
30 0.52
31 0.5
32 0.44
33 0.36
34 0.28
35 0.18
36 0.16
37 0.14
38 0.1
39 0.1
40 0.1
41 0.13
42 0.14
43 0.15
44 0.15
45 0.16
46 0.15
47 0.14
48 0.14
49 0.11
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.07
56 0.07
57 0.06
58 0.06
59 0.04
60 0.04
61 0.05
62 0.08
63 0.1
64 0.11
65 0.14
66 0.22
67 0.29
68 0.37
69 0.46
70 0.51
71 0.59
72 0.68
73 0.76
74 0.79
75 0.84
76 0.87
77 0.88
78 0.9
79 0.9
80 0.89
81 0.87
82 0.8
83 0.72
84 0.64
85 0.56
86 0.45
87 0.38
88 0.3
89 0.22
90 0.18
91 0.14
92 0.12
93 0.1
94 0.1
95 0.07
96 0.05
97 0.05
98 0.05
99 0.06
100 0.08
101 0.11
102 0.16
103 0.18
104 0.18
105 0.2
106 0.22
107 0.24
108 0.31
109 0.39
110 0.42
111 0.46
112 0.51