Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MBW2

Protein Details
Accession R0MBW2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85TKEILKTKVHRKRLTQKLYVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, E.R. 7, plas 4, pero 3, golg 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIYKKLPIFYFLIVAFSRLLTLKSLPGLLCLFVNSSKILATNLENNRIEKEPLTTETAAENCFEETKEILKTKVHRKRLTQKLYVEYLKYMLGFFIVLILFIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.14
4 0.14
5 0.11
6 0.12
7 0.1
8 0.11
9 0.11
10 0.12
11 0.14
12 0.13
13 0.14
14 0.14
15 0.13
16 0.12
17 0.11
18 0.11
19 0.1
20 0.11
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.16
29 0.18
30 0.23
31 0.24
32 0.24
33 0.26
34 0.26
35 0.25
36 0.18
37 0.18
38 0.14
39 0.15
40 0.18
41 0.15
42 0.15
43 0.15
44 0.16
45 0.14
46 0.13
47 0.11
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.13
55 0.14
56 0.15
57 0.18
58 0.25
59 0.35
60 0.44
61 0.52
62 0.54
63 0.63
64 0.72
65 0.79
66 0.81
67 0.77
68 0.74
69 0.7
70 0.71
71 0.65
72 0.55
73 0.46
74 0.38
75 0.32
76 0.26
77 0.2
78 0.13
79 0.1
80 0.09
81 0.07
82 0.08
83 0.07