Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M129

Protein Details
Accession R0M129    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
98-117SKDSEKKNQAGNKNNSKKKIHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 6, nucl 5, golg 5, cyto 3, pero 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVLMIIFIIILIFIIIYVVYIWTIWENMFGKITGLGKSENDKDKGEDTHESADDSEKLSHNPKITPRKQKSMSSDSVDDNEDKSEDSESDKVKDKTNSKDSEKKNQAGNKNNSKKKII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.05
10 0.06
11 0.06
12 0.1
13 0.11
14 0.12
15 0.13
16 0.13
17 0.13
18 0.14
19 0.16
20 0.12
21 0.12
22 0.13
23 0.13
24 0.17
25 0.22
26 0.25
27 0.26
28 0.26
29 0.27
30 0.28
31 0.28
32 0.27
33 0.24
34 0.21
35 0.21
36 0.2
37 0.19
38 0.16
39 0.16
40 0.13
41 0.13
42 0.12
43 0.1
44 0.11
45 0.14
46 0.16
47 0.16
48 0.18
49 0.25
50 0.34
51 0.41
52 0.51
53 0.54
54 0.61
55 0.64
56 0.68
57 0.67
58 0.64
59 0.61
60 0.55
61 0.52
62 0.44
63 0.4
64 0.35
65 0.28
66 0.22
67 0.17
68 0.13
69 0.11
70 0.11
71 0.1
72 0.09
73 0.12
74 0.16
75 0.17
76 0.2
77 0.27
78 0.28
79 0.32
80 0.4
81 0.42
82 0.47
83 0.55
84 0.59
85 0.6
86 0.68
87 0.68
88 0.72
89 0.75
90 0.7
91 0.69
92 0.7
93 0.72
94 0.73
95 0.77
96 0.77
97 0.79
98 0.82