Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MKI3

Protein Details
Accession R0MKI3    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKDRNRLQNRKINSKKNIRKQSSLGHydrophilic
63-91LEKALETHKKTKQHKKRVKDLKESVHTQKBasic
NLS Segment(s)
PositionSequence
71-80KKTKQHKKRV
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MAKDRNRLQNRKINSKKNIRKQSSLGFDQIQKNVENGYYPQEDEDLPGGGKFYCVECDRFFILEKALETHKKTKQHKKRVKDLKESVHTQKHAEIAAGLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.88
5 0.9
6 0.85
7 0.81
8 0.77
9 0.76
10 0.72
11 0.64
12 0.57
13 0.49
14 0.48
15 0.45
16 0.42
17 0.35
18 0.28
19 0.25
20 0.22
21 0.19
22 0.15
23 0.12
24 0.14
25 0.13
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.12
32 0.08
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.08
41 0.09
42 0.12
43 0.12
44 0.15
45 0.16
46 0.16
47 0.17
48 0.14
49 0.14
50 0.14
51 0.13
52 0.13
53 0.16
54 0.19
55 0.22
56 0.29
57 0.34
58 0.41
59 0.51
60 0.6
61 0.67
62 0.74
63 0.8
64 0.82
65 0.88
66 0.89
67 0.89
68 0.89
69 0.87
70 0.85
71 0.83
72 0.81
73 0.78
74 0.76
75 0.68
76 0.6
77 0.54
78 0.47
79 0.4
80 0.34