Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0M2W3

Protein Details
Accession R0M2W3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
144-165EYLAKKRKKMLLEKKRERLGKNBasic
NLS Segment(s)
PositionSequence
148-162KKRKKMLLEKKRERL
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR003196  TFIIF_beta  
IPR040450  TFIIF_beta_HTH  
IPR011039  TFIIF_interaction  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005674  C:transcription factor TFIIF complex  
GO:0003677  F:DNA binding  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF02270  TFIIF_beta  
Amino Acid Sequences MEINVNKKDKKVSIGKFPAFLGDRLLNMDKKTYVGDMIIGDDNTFVFKMQPNFDDIDNFPTDYSVKKIQRGNNMYVVNSDISDTFIEGEVDFEYYITPNMTKKYLDFKKKQSKIKNLDIRNSEIIDYVSEGRRNEKIGSLRELEYLAKKRKKMLLEKKRERLGKNEALDIVFNAFEKYSSWTVKDLADFTGQPTAFIQEIVDEICVVNKKDHKNTYELKNEYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.59
4 0.56
5 0.54
6 0.46
7 0.4
8 0.34
9 0.26
10 0.24
11 0.26
12 0.3
13 0.26
14 0.25
15 0.27
16 0.22
17 0.22
18 0.23
19 0.19
20 0.16
21 0.13
22 0.14
23 0.12
24 0.14
25 0.14
26 0.13
27 0.12
28 0.11
29 0.11
30 0.1
31 0.1
32 0.07
33 0.07
34 0.11
35 0.15
36 0.17
37 0.18
38 0.2
39 0.21
40 0.22
41 0.24
42 0.21
43 0.22
44 0.2
45 0.19
46 0.17
47 0.16
48 0.16
49 0.14
50 0.17
51 0.21
52 0.22
53 0.28
54 0.34
55 0.39
56 0.49
57 0.53
58 0.52
59 0.51
60 0.49
61 0.44
62 0.38
63 0.34
64 0.24
65 0.19
66 0.16
67 0.08
68 0.09
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.06
75 0.07
76 0.06
77 0.06
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.07
86 0.08
87 0.1
88 0.1
89 0.11
90 0.21
91 0.28
92 0.36
93 0.4
94 0.49
95 0.59
96 0.66
97 0.73
98 0.72
99 0.75
100 0.73
101 0.78
102 0.77
103 0.69
104 0.68
105 0.62
106 0.57
107 0.49
108 0.42
109 0.32
110 0.24
111 0.2
112 0.14
113 0.12
114 0.1
115 0.11
116 0.12
117 0.12
118 0.15
119 0.16
120 0.17
121 0.17
122 0.2
123 0.23
124 0.24
125 0.27
126 0.27
127 0.27
128 0.26
129 0.26
130 0.23
131 0.24
132 0.28
133 0.34
134 0.36
135 0.37
136 0.42
137 0.46
138 0.53
139 0.58
140 0.61
141 0.63
142 0.7
143 0.78
144 0.81
145 0.84
146 0.82
147 0.74
148 0.7
149 0.68
150 0.64
151 0.57
152 0.51
153 0.44
154 0.38
155 0.36
156 0.29
157 0.21
158 0.13
159 0.11
160 0.09
161 0.08
162 0.07
163 0.08
164 0.12
165 0.16
166 0.17
167 0.19
168 0.2
169 0.22
170 0.23
171 0.24
172 0.21
173 0.18
174 0.19
175 0.18
176 0.18
177 0.23
178 0.21
179 0.2
180 0.19
181 0.2
182 0.17
183 0.17
184 0.15
185 0.08
186 0.09
187 0.1
188 0.09
189 0.07
190 0.07
191 0.1
192 0.13
193 0.14
194 0.2
195 0.27
196 0.34
197 0.44
198 0.51
199 0.51
200 0.56
201 0.63
202 0.66
203 0.69