Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KRT6

Protein Details
Accession R0KRT6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-38KILLRREYKKHIQNIKKSRTREKHFKYKNIGBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MEEEDEDKILLRREYKKHIQNIKKSRTREKHFKYKNIGYTEALENYEDDIKYFSILFGYLERKQDNETNLNET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.58
4 0.64
5 0.72
6 0.75
7 0.77
8 0.82
9 0.84
10 0.81
11 0.79
12 0.8
13 0.8
14 0.79
15 0.79
16 0.77
17 0.78
18 0.78
19 0.8
20 0.78
21 0.74
22 0.72
23 0.64
24 0.58
25 0.48
26 0.44
27 0.38
28 0.3
29 0.24
30 0.17
31 0.14
32 0.13
33 0.14
34 0.11
35 0.1
36 0.1
37 0.09
38 0.1
39 0.1
40 0.08
41 0.06
42 0.07
43 0.08
44 0.09
45 0.15
46 0.18
47 0.22
48 0.23
49 0.24
50 0.28
51 0.32
52 0.35
53 0.36