Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M5L9

Protein Details
Accession R0M5L9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-99ITLRNKNEFKKSRKKKNSIYEKSIIHydrophilic
NLS Segment(s)
PositionSequence
84-90KKSRKKK
Subcellular Location(s) nucl 17, cyto_nucl 10.5, pero 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDTITLFYEANFILKRDQYKNEDDIYGMVILREMPLMFRKRDVQCPNIVNMFIKLFNISLKYVKNLFRNNKEQEITLRNKNEFKKSRKKKNSIYEKSIISKINSIEQEIAQLEKNLHNLINHIKGKTRCKIKNTICFSLLKICVPLIIMFGFKEFQIRLNQRKSIIEIKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.31
4 0.38
5 0.4
6 0.45
7 0.48
8 0.46
9 0.43
10 0.37
11 0.32
12 0.27
13 0.22
14 0.16
15 0.11
16 0.09
17 0.08
18 0.08
19 0.08
20 0.06
21 0.07
22 0.14
23 0.18
24 0.19
25 0.22
26 0.3
27 0.33
28 0.43
29 0.47
30 0.44
31 0.47
32 0.49
33 0.49
34 0.43
35 0.4
36 0.31
37 0.27
38 0.24
39 0.16
40 0.14
41 0.11
42 0.1
43 0.1
44 0.11
45 0.11
46 0.13
47 0.13
48 0.16
49 0.19
50 0.24
51 0.29
52 0.36
53 0.42
54 0.46
55 0.54
56 0.55
57 0.56
58 0.52
59 0.47
60 0.43
61 0.42
62 0.39
63 0.38
64 0.37
65 0.34
66 0.39
67 0.41
68 0.46
69 0.48
70 0.52
71 0.57
72 0.64
73 0.73
74 0.77
75 0.83
76 0.82
77 0.84
78 0.87
79 0.84
80 0.81
81 0.74
82 0.66
83 0.61
84 0.55
85 0.47
86 0.36
87 0.31
88 0.25
89 0.26
90 0.23
91 0.21
92 0.18
93 0.16
94 0.17
95 0.15
96 0.15
97 0.1
98 0.11
99 0.11
100 0.11
101 0.13
102 0.12
103 0.13
104 0.12
105 0.14
106 0.17
107 0.25
108 0.26
109 0.26
110 0.31
111 0.36
112 0.43
113 0.49
114 0.55
115 0.52
116 0.56
117 0.65
118 0.68
119 0.72
120 0.73
121 0.7
122 0.62
123 0.57
124 0.53
125 0.5
126 0.43
127 0.34
128 0.27
129 0.22
130 0.2
131 0.19
132 0.18
133 0.11
134 0.1
135 0.1
136 0.09
137 0.11
138 0.11
139 0.1
140 0.13
141 0.12
142 0.15
143 0.24
144 0.32
145 0.4
146 0.47
147 0.52
148 0.52
149 0.55
150 0.57
151 0.55