Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KSL8

Protein Details
Accession R0KSL8    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
17-40VIYNPKDKKFYHKKKNLNEFNFKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6E.R. 6, plas 4, pero 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLFTASLLPKIEIPTLVIYNPKDKKFYHKKKNLNEFNFKEVAEETLKLFDQGKLKVYGSKNYGIYYLIGGLIVMGVIGCWIKMRRKPII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.2
5 0.19
6 0.27
7 0.33
8 0.33
9 0.34
10 0.33
11 0.43
12 0.51
13 0.6
14 0.62
15 0.66
16 0.74
17 0.8
18 0.9
19 0.9
20 0.86
21 0.85
22 0.76
23 0.71
24 0.63
25 0.52
26 0.42
27 0.32
28 0.27
29 0.18
30 0.15
31 0.11
32 0.1
33 0.1
34 0.1
35 0.11
36 0.11
37 0.14
38 0.14
39 0.17
40 0.18
41 0.18
42 0.24
43 0.25
44 0.28
45 0.27
46 0.31
47 0.29
48 0.27
49 0.28
50 0.22
51 0.2
52 0.16
53 0.13
54 0.09
55 0.07
56 0.06
57 0.05
58 0.04
59 0.04
60 0.03
61 0.02
62 0.02
63 0.03
64 0.03
65 0.03
66 0.06
67 0.1
68 0.18
69 0.24