Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MKW0

Protein Details
Accession R0MKW0   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
33-52CPHCSKIYPRIYKKDKRRLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto_nucl 7, nucl 6.5, cyto 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031493  Zinc_ribbon_15  
Pfam View protein in Pfam  
PF17032  zinc_ribbon_15  
Amino Acid Sequences MCNPCCLIIGCDTKSKEVPKPENWPDLKGDMLCPHCSKIYPRIYKKDKRRLAICFIPICPCGSSDTYMACSYCGLKVNASKDTICHRCQVDTPFECDYCPNCGTSKRGGENARQLNLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.42
4 0.45
5 0.5
6 0.51
7 0.59
8 0.62
9 0.66
10 0.63
11 0.6
12 0.53
13 0.47
14 0.42
15 0.33
16 0.28
17 0.24
18 0.25
19 0.26
20 0.25
21 0.25
22 0.23
23 0.24
24 0.25
25 0.29
26 0.36
27 0.42
28 0.48
29 0.56
30 0.65
31 0.72
32 0.8
33 0.81
34 0.78
35 0.75
36 0.74
37 0.69
38 0.66
39 0.62
40 0.56
41 0.47
42 0.41
43 0.37
44 0.32
45 0.28
46 0.21
47 0.16
48 0.14
49 0.13
50 0.14
51 0.12
52 0.12
53 0.14
54 0.14
55 0.13
56 0.11
57 0.11
58 0.1
59 0.11
60 0.13
61 0.11
62 0.13
63 0.17
64 0.2
65 0.22
66 0.23
67 0.21
68 0.21
69 0.28
70 0.32
71 0.29
72 0.31
73 0.29
74 0.29
75 0.33
76 0.36
77 0.37
78 0.34
79 0.37
80 0.36
81 0.35
82 0.33
83 0.32
84 0.29
85 0.25
86 0.24
87 0.21
88 0.2
89 0.24
90 0.27
91 0.32
92 0.38
93 0.38
94 0.45
95 0.47
96 0.52
97 0.59
98 0.63