Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KXQ8

Protein Details
Accession R0KXQ8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-86KILKGNCEKIKKKKKVYKEISKRFNLLHydrophilic
NLS Segment(s)
PositionSequence
68-88KIKKKKKVYKEISKRFNLLKK
Subcellular Location(s) mito 11.5, mito_nucl 10.5, nucl 8.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MLVYMGFRSLFPLFLHKSPFPFLTLPPLSSYTPLPFHFVMKKYNLILLLEKLEEEKNKYKILKGNCEKIKKKKKVYKEISKRFNLLKKKDEKYYELCKEITGDKPKRECLEEIKGKLNKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.29
4 0.32
5 0.33
6 0.33
7 0.3
8 0.27
9 0.25
10 0.28
11 0.28
12 0.26
13 0.25
14 0.27
15 0.24
16 0.25
17 0.26
18 0.2
19 0.22
20 0.21
21 0.23
22 0.2
23 0.23
24 0.27
25 0.27
26 0.28
27 0.27
28 0.29
29 0.26
30 0.27
31 0.24
32 0.2
33 0.19
34 0.16
35 0.15
36 0.12
37 0.11
38 0.11
39 0.12
40 0.12
41 0.15
42 0.19
43 0.2
44 0.24
45 0.25
46 0.26
47 0.3
48 0.34
49 0.4
50 0.39
51 0.46
52 0.49
53 0.58
54 0.62
55 0.67
56 0.73
57 0.72
58 0.78
59 0.77
60 0.81
61 0.83
62 0.87
63 0.87
64 0.87
65 0.88
66 0.86
67 0.82
68 0.75
69 0.71
70 0.68
71 0.66
72 0.62
73 0.61
74 0.61
75 0.63
76 0.66
77 0.65
78 0.62
79 0.6
80 0.64
81 0.61
82 0.55
83 0.5
84 0.43
85 0.4
86 0.39
87 0.4
88 0.4
89 0.41
90 0.45
91 0.5
92 0.56
93 0.58
94 0.58
95 0.54
96 0.52
97 0.56
98 0.57
99 0.56
100 0.59