Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MEX2

Protein Details
Accession R0MEX2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-23LENRKTWCTKKYLKKVRSTEILHydrophilic
NLS Segment(s)
PositionSequence
24-55LRRKSIEPIKKTKSIREQKKIKLTPKKISTPK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MLENRKTWCTKKYLKKVRSTEILLRRKSIEPIKKTKSIREQKKIKLTPKKISTPKRIINIVSPGMYTEIKSNKSKTKYSSVRRIDFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.84
4 0.82
5 0.79
6 0.74
7 0.72
8 0.71
9 0.71
10 0.63
11 0.58
12 0.54
13 0.48
14 0.48
15 0.48
16 0.46
17 0.45
18 0.52
19 0.56
20 0.6
21 0.6
22 0.62
23 0.64
24 0.65
25 0.68
26 0.69
27 0.71
28 0.71
29 0.8
30 0.79
31 0.77
32 0.77
33 0.74
34 0.73
35 0.71
36 0.73
37 0.72
38 0.74
39 0.75
40 0.73
41 0.72
42 0.68
43 0.65
44 0.57
45 0.52
46 0.48
47 0.41
48 0.32
49 0.26
50 0.21
51 0.21
52 0.2
53 0.16
54 0.16
55 0.19
56 0.24
57 0.28
58 0.33
59 0.39
60 0.44
61 0.49
62 0.5
63 0.55
64 0.61
65 0.66
66 0.72
67 0.73