Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M1N6

Protein Details
Accession R0M1N6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-111FKSKAIEKLKKNNPKIVNRRIREHydrophilic
NLS Segment(s)
PositionSequence
98-103KKNNPK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MVNSVDKNVQVIFESKRKKSSELEDIETKKLKIKYEGNDTEIVKKEVSHKKCSFCKRKLGIVTSYTCRCGDNFCSRHRFCDQHNCSFDFKSKAIEKLKKNNPKIVNRRIRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.43
4 0.44
5 0.47
6 0.49
7 0.52
8 0.53
9 0.51
10 0.54
11 0.54
12 0.55
13 0.55
14 0.51
15 0.44
16 0.4
17 0.38
18 0.35
19 0.34
20 0.38
21 0.4
22 0.47
23 0.5
24 0.47
25 0.48
26 0.46
27 0.44
28 0.4
29 0.35
30 0.25
31 0.22
32 0.28
33 0.33
34 0.36
35 0.4
36 0.42
37 0.48
38 0.56
39 0.65
40 0.66
41 0.62
42 0.68
43 0.62
44 0.64
45 0.62
46 0.58
47 0.52
48 0.46
49 0.44
50 0.39
51 0.36
52 0.32
53 0.27
54 0.24
55 0.2
56 0.2
57 0.22
58 0.28
59 0.31
60 0.35
61 0.44
62 0.44
63 0.49
64 0.5
65 0.48
66 0.43
67 0.51
68 0.51
69 0.51
70 0.55
71 0.53
72 0.51
73 0.49
74 0.49
75 0.42
76 0.37
77 0.35
78 0.34
79 0.39
80 0.46
81 0.52
82 0.56
83 0.62
84 0.72
85 0.75
86 0.77
87 0.79
88 0.79
89 0.81
90 0.83
91 0.84