Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KND0

Protein Details
Accession R0KND0   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-113QKTFGKSKAEAKKHRPLYKKYCDLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006569  CID_dom  
IPR008942  ENTH_VHS  
Pfam View protein in Pfam  
PF04818  CID  
PROSITE View protein in PROSITE  
PS51391  CID  
Amino Acid Sequences MFLFSKDYFLKQLKQLSPTEEQIKTLGLYIKTFKEEYKNIMEAFEYVYNSSNSHHKLIMLYLANEILQTDKSYDADSLQLKKELREFIQKTFGKSKAEAKKHRPLYKKYCDLENVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.45
4 0.46
5 0.47
6 0.47
7 0.39
8 0.36
9 0.32
10 0.3
11 0.25
12 0.23
13 0.21
14 0.16
15 0.17
16 0.19
17 0.2
18 0.22
19 0.22
20 0.21
21 0.23
22 0.24
23 0.27
24 0.3
25 0.3
26 0.27
27 0.27
28 0.26
29 0.19
30 0.2
31 0.17
32 0.12
33 0.1
34 0.11
35 0.11
36 0.11
37 0.12
38 0.14
39 0.15
40 0.16
41 0.16
42 0.14
43 0.14
44 0.14
45 0.17
46 0.13
47 0.11
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.08
60 0.08
61 0.08
62 0.12
63 0.14
64 0.16
65 0.17
66 0.21
67 0.21
68 0.22
69 0.26
70 0.26
71 0.26
72 0.34
73 0.35
74 0.34
75 0.44
76 0.44
77 0.45
78 0.48
79 0.49
80 0.42
81 0.43
82 0.49
83 0.49
84 0.58
85 0.62
86 0.63
87 0.7
88 0.76
89 0.82
90 0.82
91 0.82
92 0.82
93 0.83
94 0.85
95 0.78
96 0.75