Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MQB6

Protein Details
Accession R0MQB6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-30AKQTNKDFDKYRKLKRKFKKLQETNVLLKHydrophilic
NLS Segment(s)
PositionSequence
13-20RKLKRKFK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MAKQTNKDFDKYRKLKRKFKKLQETNVLLKLQIKKIENFYLNKINFYKKQFNEEKEGFYSDYESLMAKYLNLITKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.89
5 0.89
6 0.91
7 0.91
8 0.89
9 0.9
10 0.89
11 0.84
12 0.77
13 0.71
14 0.6
15 0.49
16 0.45
17 0.39
18 0.32
19 0.31
20 0.28
21 0.25
22 0.28
23 0.33
24 0.32
25 0.3
26 0.3
27 0.34
28 0.32
29 0.33
30 0.32
31 0.32
32 0.33
33 0.38
34 0.43
35 0.36
36 0.45
37 0.49
38 0.51
39 0.55
40 0.52
41 0.49
42 0.42
43 0.43
44 0.35
45 0.28
46 0.27
47 0.19
48 0.18
49 0.14
50 0.12
51 0.1
52 0.11
53 0.11
54 0.08
55 0.1
56 0.13