Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M5G9

Protein Details
Accession R0M5G9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
31-56IAQGCFFHKNHKKNNRSNVKKKYTIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MNSKEMKKHENISNKTAFKKFIKVKTASPCIAQGCFFHKNHKKNNRSNVKKKYTIFVKSLHSIKRSTVTLYEEYVNLFRTNDNFFGPRKCCIINEIHQCNIISCSFDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.59
4 0.57
5 0.5
6 0.54
7 0.55
8 0.54
9 0.58
10 0.55
11 0.59
12 0.63
13 0.66
14 0.58
15 0.51
16 0.46
17 0.4
18 0.38
19 0.31
20 0.24
21 0.22
22 0.27
23 0.26
24 0.33
25 0.39
26 0.46
27 0.56
28 0.65
29 0.68
30 0.71
31 0.81
32 0.82
33 0.83
34 0.86
35 0.86
36 0.83
37 0.8
38 0.73
39 0.69
40 0.64
41 0.58
42 0.5
43 0.43
44 0.39
45 0.37
46 0.4
47 0.37
48 0.33
49 0.29
50 0.28
51 0.28
52 0.26
53 0.22
54 0.21
55 0.21
56 0.2
57 0.21
58 0.21
59 0.17
60 0.17
61 0.17
62 0.16
63 0.13
64 0.12
65 0.11
66 0.12
67 0.15
68 0.15
69 0.17
70 0.18
71 0.2
72 0.27
73 0.28
74 0.29
75 0.29
76 0.29
77 0.27
78 0.29
79 0.34
80 0.36
81 0.44
82 0.47
83 0.45
84 0.46
85 0.46
86 0.43
87 0.39
88 0.3