Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0M1T1

Protein Details
Accession R0M1T1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-30LILIKTSTRLRRRIKNDFCLGCHydrophilic
134-160KLRKVLMLRKHTKPRQKGNKIESIKKTBasic
NLS Segment(s)
PositionSequence
132-153YKKLRKVLMLRKHTKPRQKGNK
Subcellular Location(s) mito 15.5, mito_nucl 12.833, nucl 9, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MKIFFVGLLILIKTSTRLRRRIKNDFCLGCNGHRNLKGHDLSKPNLFRFADKNKIPFDNTTEHNQNVLKEIKSDEENVEQICDKESSNEESSGDFDYVYENFDEIMKFLEKTSYNEPPKETLDMCKPVKIPYKKLRKVLMLRKHTKPRQKGNKIESIKKTYPVQAPCYVMQNRNKMTEKKVNNEKDLYEFQDSLSESSEEKSLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.26
3 0.32
4 0.42
5 0.51
6 0.61
7 0.7
8 0.78
9 0.81
10 0.81
11 0.84
12 0.79
13 0.72
14 0.69
15 0.63
16 0.57
17 0.55
18 0.49
19 0.46
20 0.46
21 0.47
22 0.43
23 0.49
24 0.48
25 0.42
26 0.46
27 0.44
28 0.42
29 0.48
30 0.5
31 0.42
32 0.44
33 0.43
34 0.39
35 0.41
36 0.46
37 0.47
38 0.44
39 0.48
40 0.44
41 0.47
42 0.45
43 0.4
44 0.37
45 0.33
46 0.32
47 0.35
48 0.35
49 0.32
50 0.33
51 0.32
52 0.28
53 0.27
54 0.28
55 0.21
56 0.18
57 0.19
58 0.19
59 0.19
60 0.2
61 0.18
62 0.16
63 0.17
64 0.16
65 0.16
66 0.14
67 0.13
68 0.12
69 0.11
70 0.09
71 0.1
72 0.11
73 0.15
74 0.16
75 0.17
76 0.16
77 0.15
78 0.16
79 0.16
80 0.14
81 0.09
82 0.07
83 0.08
84 0.07
85 0.08
86 0.07
87 0.05
88 0.05
89 0.06
90 0.06
91 0.05
92 0.07
93 0.06
94 0.07
95 0.07
96 0.1
97 0.11
98 0.14
99 0.19
100 0.26
101 0.29
102 0.31
103 0.32
104 0.31
105 0.32
106 0.31
107 0.27
108 0.21
109 0.24
110 0.3
111 0.29
112 0.29
113 0.28
114 0.31
115 0.4
116 0.41
117 0.45
118 0.47
119 0.58
120 0.61
121 0.67
122 0.67
123 0.66
124 0.71
125 0.72
126 0.73
127 0.72
128 0.73
129 0.75
130 0.8
131 0.79
132 0.8
133 0.79
134 0.8
135 0.81
136 0.84
137 0.85
138 0.82
139 0.84
140 0.81
141 0.8
142 0.77
143 0.74
144 0.67
145 0.61
146 0.57
147 0.54
148 0.54
149 0.5
150 0.48
151 0.44
152 0.46
153 0.43
154 0.47
155 0.45
156 0.44
157 0.47
158 0.5
159 0.48
160 0.53
161 0.58
162 0.55
163 0.59
164 0.62
165 0.61
166 0.62
167 0.69
168 0.69
169 0.68
170 0.67
171 0.61
172 0.57
173 0.55
174 0.5
175 0.44
176 0.37
177 0.31
178 0.33
179 0.32
180 0.27
181 0.25
182 0.21
183 0.16
184 0.18