Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KMZ7

Protein Details
Accession R0KMZ7   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
143-163NNCGMHRRPPCQKYHYKRKFFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029055  Ntn_hydrolases_N  
IPR001353  Proteasome_sua/b  
IPR023333  Proteasome_suB-type  
Gene Ontology GO:0005839  C:proteasome core complex  
GO:0051603  P:proteolysis involved in protein catabolic process  
Pfam View protein in Pfam  
PF00227  Proteasome  
Amino Acid Sequences MEALVGLKGRDFVLVSAESSVMNSYLVIKRKDDKFSDLNENVTLVYNGDQGDAFRTAKFVVEDLKYRQLESNLKINPKVVSCSIQNKIYEKLRVNPLKCGFLVGGMSCNNPELYSIDNYGASFKENFIAMGMGTYFCYGILDNNCGMHRRPPCQKYHYKRKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.12
6 0.12
7 0.12
8 0.08
9 0.07
10 0.07
11 0.1
12 0.15
13 0.21
14 0.22
15 0.25
16 0.32
17 0.38
18 0.44
19 0.43
20 0.45
21 0.44
22 0.47
23 0.54
24 0.48
25 0.44
26 0.38
27 0.35
28 0.29
29 0.24
30 0.19
31 0.1
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.08
38 0.1
39 0.11
40 0.11
41 0.1
42 0.1
43 0.1
44 0.11
45 0.11
46 0.1
47 0.11
48 0.12
49 0.15
50 0.18
51 0.25
52 0.24
53 0.25
54 0.26
55 0.26
56 0.29
57 0.28
58 0.33
59 0.28
60 0.3
61 0.3
62 0.29
63 0.27
64 0.23
65 0.23
66 0.16
67 0.15
68 0.16
69 0.21
70 0.22
71 0.24
72 0.25
73 0.24
74 0.27
75 0.28
76 0.31
77 0.28
78 0.3
79 0.36
80 0.41
81 0.4
82 0.44
83 0.43
84 0.4
85 0.38
86 0.35
87 0.25
88 0.2
89 0.19
90 0.12
91 0.12
92 0.1
93 0.11
94 0.09
95 0.1
96 0.09
97 0.08
98 0.09
99 0.07
100 0.1
101 0.11
102 0.12
103 0.12
104 0.13
105 0.13
106 0.13
107 0.12
108 0.12
109 0.1
110 0.09
111 0.1
112 0.1
113 0.1
114 0.09
115 0.09
116 0.07
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.06
123 0.06
124 0.07
125 0.06
126 0.11
127 0.13
128 0.15
129 0.16
130 0.18
131 0.2
132 0.22
133 0.23
134 0.26
135 0.31
136 0.36
137 0.46
138 0.51
139 0.58
140 0.66
141 0.75
142 0.78
143 0.83