Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MHM6

Protein Details
Accession R0MHM6   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-37FFGGKNKKNKNIKLYCNNVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, mito_nucl 12, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001404  Hsp90_fam  
IPR020568  Ribosomal_S5_D2-typ_fold  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0140662  F:ATP-dependent protein folding chaperone  
GO:0051082  F:unfolded protein binding  
Pfam View protein in Pfam  
PF00183  HSP90  
Amino Acid Sequences MLTLKLLLFIPKRSRMDFFGGKNKKNKNIKLYCNNVFVTDDFGDNIPEWMNFVVGVVASSDISMNVSRELIQGSSLMKLVKKTLPQKVLDMINKLSNDQEKYSSFYNEFGNCLKLAVMEAQDNPREKFVNTLRYSTNKNENISFKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.51
4 0.51
5 0.5
6 0.52
7 0.57
8 0.6
9 0.65
10 0.68
11 0.7
12 0.73
13 0.74
14 0.74
15 0.75
16 0.79
17 0.8
18 0.8
19 0.76
20 0.71
21 0.64
22 0.54
23 0.46
24 0.36
25 0.31
26 0.24
27 0.19
28 0.15
29 0.14
30 0.14
31 0.12
32 0.13
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.1
67 0.12
68 0.18
69 0.24
70 0.3
71 0.35
72 0.35
73 0.37
74 0.38
75 0.42
76 0.38
77 0.34
78 0.29
79 0.28
80 0.27
81 0.25
82 0.23
83 0.22
84 0.21
85 0.2
86 0.22
87 0.19
88 0.22
89 0.23
90 0.24
91 0.21
92 0.21
93 0.23
94 0.2
95 0.21
96 0.2
97 0.19
98 0.17
99 0.16
100 0.14
101 0.1
102 0.1
103 0.1
104 0.11
105 0.11
106 0.13
107 0.17
108 0.22
109 0.25
110 0.25
111 0.26
112 0.26
113 0.24
114 0.3
115 0.33
116 0.39
117 0.38
118 0.41
119 0.43
120 0.46
121 0.52
122 0.5
123 0.54
124 0.49
125 0.5
126 0.53
127 0.57