Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KYL7

Protein Details
Accession R0KYL7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
88-127MVVRKTGESKIKKPRRTRKDERKKRYKRFGTIKRAVKKAEBasic
NLS Segment(s)
PositionSequence
93-131TGESKIKKPRRTRKDERKKRYKRFGTIKRAVKKAERKDK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MSCEIEVITNKKNELLGRNELTLNINHERSSVPTKKDIANQISKLFQTKGDSIIVYDISNNPGTHSSVGKVNVYSSVDAMKKVEKDYMVVRKTGESKIKKPRRTRKDERKKRYKRFGTIKRAVKKAERKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.36
4 0.36
5 0.38
6 0.37
7 0.35
8 0.33
9 0.28
10 0.28
11 0.24
12 0.22
13 0.2
14 0.21
15 0.2
16 0.23
17 0.3
18 0.31
19 0.29
20 0.33
21 0.36
22 0.39
23 0.44
24 0.47
25 0.45
26 0.46
27 0.46
28 0.43
29 0.42
30 0.4
31 0.36
32 0.29
33 0.24
34 0.21
35 0.19
36 0.19
37 0.18
38 0.17
39 0.15
40 0.15
41 0.13
42 0.1
43 0.09
44 0.08
45 0.09
46 0.11
47 0.1
48 0.1
49 0.1
50 0.11
51 0.12
52 0.12
53 0.11
54 0.12
55 0.13
56 0.13
57 0.12
58 0.11
59 0.12
60 0.13
61 0.12
62 0.09
63 0.11
64 0.11
65 0.12
66 0.12
67 0.13
68 0.13
69 0.14
70 0.16
71 0.13
72 0.15
73 0.21
74 0.29
75 0.28
76 0.27
77 0.27
78 0.28
79 0.31
80 0.35
81 0.38
82 0.35
83 0.42
84 0.53
85 0.62
86 0.67
87 0.75
88 0.8
89 0.82
90 0.86
91 0.89
92 0.9
93 0.91
94 0.94
95 0.94
96 0.95
97 0.95
98 0.96
99 0.96
100 0.94
101 0.93
102 0.93
103 0.93
104 0.92
105 0.91
106 0.9
107 0.87
108 0.83
109 0.79
110 0.78
111 0.77