Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KW05

Protein Details
Accession R0KW05   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-90LVYFGFRKYKERRKKIGCADEQELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 7.5, E.R. 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNKSEVTLSPLNGEIMLHDINENNQPPKYDAFTSLGPEHLNETELAAAENFITFASIVFVVGLLIFLVYFGFRKYKERRKKIGCADEQELYNDLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.1
5 0.09
6 0.09
7 0.11
8 0.16
9 0.19
10 0.18
11 0.18
12 0.2
13 0.21
14 0.23
15 0.25
16 0.21
17 0.21
18 0.22
19 0.22
20 0.24
21 0.23
22 0.21
23 0.18
24 0.17
25 0.16
26 0.13
27 0.12
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.05
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.05
58 0.08
59 0.09
60 0.18
61 0.28
62 0.39
63 0.5
64 0.6
65 0.7
66 0.75
67 0.85
68 0.87
69 0.88
70 0.85
71 0.82
72 0.76
73 0.7
74 0.62
75 0.54