Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0MLV1

Protein Details
Accession R0MLV1    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-143LNSFNLKYSKPKERRRRYYDHydrophilic
NLS Segment(s)
PositionSequence
92-96KKERG
134-138PKERR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MFNHTNLFLCIHFITILTTTAETTRTQKDINRRGRPDPSEYGAKPRQGYKTSKSMSAEELMEKIDELNDLINESMEKIEDYNESLRQLTPRKKERGGWEEKKFSTKPYKQALKNDLKSLGAKALNSFNLKYSKPKERRRRYYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.11
5 0.11
6 0.11
7 0.11
8 0.13
9 0.13
10 0.16
11 0.19
12 0.2
13 0.22
14 0.26
15 0.36
16 0.45
17 0.54
18 0.6
19 0.61
20 0.64
21 0.71
22 0.7
23 0.66
24 0.61
25 0.55
26 0.52
27 0.48
28 0.5
29 0.46
30 0.46
31 0.41
32 0.41
33 0.43
34 0.4
35 0.45
36 0.41
37 0.46
38 0.44
39 0.47
40 0.44
41 0.39
42 0.36
43 0.32
44 0.28
45 0.19
46 0.18
47 0.14
48 0.11
49 0.1
50 0.08
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.07
68 0.09
69 0.1
70 0.11
71 0.12
72 0.12
73 0.16
74 0.23
75 0.28
76 0.35
77 0.43
78 0.48
79 0.51
80 0.56
81 0.61
82 0.63
83 0.66
84 0.67
85 0.66
86 0.67
87 0.65
88 0.67
89 0.58
90 0.54
91 0.55
92 0.52
93 0.52
94 0.55
95 0.63
96 0.62
97 0.71
98 0.75
99 0.74
100 0.73
101 0.69
102 0.61
103 0.53
104 0.49
105 0.41
106 0.38
107 0.29
108 0.25
109 0.23
110 0.26
111 0.28
112 0.29
113 0.28
114 0.27
115 0.3
116 0.31
117 0.38
118 0.4
119 0.47
120 0.55
121 0.65
122 0.72
123 0.78