Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0MEU8

Protein Details
Accession R0MEU8    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28VPKNHRNTMKRVKEWHNQKIRAHydrophilic
NLS Segment(s)
PositionSequence
30-31RR
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MRNNNAVPKNHRNTMKRVKEWHNQKIRAERRAHTRVVKAKQVYPRPTEKLRPIVRCPTVRYNTKQRLGRGFTPEECQAAGLDYNYARTIGISVDNRRRNMNQESFDLNVERIKTYVSRLTIYKTAKEAMESGVEQFKKTIMPVVRVKPSIAIIKKSEISSIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.73
4 0.75
5 0.76
6 0.77
7 0.82
8 0.83
9 0.82
10 0.78
11 0.77
12 0.79
13 0.78
14 0.77
15 0.73
16 0.68
17 0.67
18 0.67
19 0.66
20 0.61
21 0.61
22 0.62
23 0.62
24 0.64
25 0.58
26 0.58
27 0.61
28 0.64
29 0.62
30 0.58
31 0.6
32 0.58
33 0.6
34 0.61
35 0.58
36 0.59
37 0.6
38 0.61
39 0.59
40 0.62
41 0.62
42 0.59
43 0.58
44 0.57
45 0.56
46 0.56
47 0.57
48 0.59
49 0.61
50 0.64
51 0.64
52 0.58
53 0.59
54 0.58
55 0.57
56 0.52
57 0.46
58 0.4
59 0.39
60 0.36
61 0.29
62 0.23
63 0.19
64 0.13
65 0.1
66 0.09
67 0.06
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.09
78 0.11
79 0.17
80 0.25
81 0.3
82 0.31
83 0.34
84 0.35
85 0.37
86 0.42
87 0.43
88 0.37
89 0.36
90 0.37
91 0.36
92 0.35
93 0.3
94 0.23
95 0.18
96 0.16
97 0.13
98 0.11
99 0.11
100 0.11
101 0.13
102 0.17
103 0.17
104 0.19
105 0.2
106 0.24
107 0.29
108 0.31
109 0.3
110 0.28
111 0.28
112 0.26
113 0.26
114 0.23
115 0.18
116 0.19
117 0.17
118 0.17
119 0.21
120 0.21
121 0.2
122 0.19
123 0.18
124 0.16
125 0.16
126 0.22
127 0.18
128 0.25
129 0.32
130 0.39
131 0.45
132 0.46
133 0.46
134 0.41
135 0.42
136 0.44
137 0.41
138 0.39
139 0.36
140 0.4
141 0.43
142 0.41