Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D2W2

Protein Details
Accession B0D2W2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-55GRNRPSSPVIREKKKKERKKKKEISRRRVAVQPBasic
NLS Segment(s)
PositionSequence
27-50PSSPVIREKKKKERKKKKEISRRR
Subcellular Location(s) mito 16, nucl 7, cyto 2, plas 2
Family & Domain DBs
KEGG lbc:LACBIDRAFT_315666  -  
Amino Acid Sequences MTTQPPHGDMGAIRSTATALVHGRNRPSSPVIREKKKKERKKKKEISRRRVAVQPPHGDMDANAQRLPPWFTVSAPSQPPVVSRLSPNGRLHYSARSTARLAGHDRAAMSPQHPVLSEDVRLSSLLTVTWMPTLNGYCPGSRCRYRPSPPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.12
6 0.11
7 0.17
8 0.22
9 0.25
10 0.29
11 0.32
12 0.34
13 0.34
14 0.38
15 0.39
16 0.4
17 0.48
18 0.53
19 0.59
20 0.68
21 0.74
22 0.8
23 0.84
24 0.88
25 0.89
26 0.91
27 0.92
28 0.94
29 0.95
30 0.95
31 0.95
32 0.96
33 0.95
34 0.94
35 0.88
36 0.8
37 0.77
38 0.72
39 0.7
40 0.67
41 0.6
42 0.52
43 0.48
44 0.44
45 0.37
46 0.3
47 0.29
48 0.24
49 0.21
50 0.19
51 0.17
52 0.18
53 0.19
54 0.22
55 0.14
56 0.13
57 0.12
58 0.12
59 0.15
60 0.17
61 0.19
62 0.17
63 0.17
64 0.15
65 0.15
66 0.15
67 0.14
68 0.14
69 0.11
70 0.12
71 0.18
72 0.21
73 0.27
74 0.28
75 0.3
76 0.29
77 0.31
78 0.32
79 0.3
80 0.29
81 0.28
82 0.28
83 0.27
84 0.27
85 0.28
86 0.28
87 0.26
88 0.27
89 0.25
90 0.24
91 0.23
92 0.22
93 0.19
94 0.19
95 0.17
96 0.14
97 0.15
98 0.14
99 0.14
100 0.14
101 0.15
102 0.16
103 0.17
104 0.18
105 0.16
106 0.15
107 0.15
108 0.15
109 0.14
110 0.11
111 0.09
112 0.08
113 0.08
114 0.08
115 0.08
116 0.1
117 0.1
118 0.1
119 0.12
120 0.14
121 0.14
122 0.2
123 0.21
124 0.21
125 0.23
126 0.29
127 0.34
128 0.39
129 0.42
130 0.45
131 0.53